Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries) |
Domain d5da5v_: 5da5 V: [321150] Other proteins in same PDB: d5da5a2, d5da5b2, d5da5d2, d5da5f2, d5da5g2, d5da5h2, d5da5i2, d5da5j2, d5da5k2, d5da5l2, d5da5n2, d5da5p2, d5da5t2, d5da5u2 automated match to d1zpyg_ complexed with ca, fe, goa |
PDB Entry: 5da5 (more details), 2.06 Å
SCOPe Domain Sequences for d5da5v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5da5v_ a.25.1.0 (V:) automated matches {Rhodospirillum rubrum [TaxId: 1085]} stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha amtlewlrrndakwaehlrtylftegpita
Timeline for d5da5v_:
View in 3D Domains from other chains: (mouse over for more information) d5da5a1, d5da5a2, d5da5b1, d5da5b2, d5da5c_, d5da5d1, d5da5d2, d5da5e_, d5da5f1, d5da5f2, d5da5g1, d5da5g2, d5da5h1, d5da5h2, d5da5i1, d5da5i2, d5da5j1, d5da5j2, d5da5k1, d5da5k2, d5da5l1, d5da5l2, d5da5m_, d5da5n1, d5da5n2, d5da5o_, d5da5p1, d5da5p2, d5da5q_, d5da5r_, d5da5s_, d5da5t1, d5da5t2, d5da5u1, d5da5u2, d5da5w_, d5da5x_, d5da5y_, d5da5z_ |