![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52627] (9 PDB entries) |
![]() | Domain d1efua3: 1efu A:9-204 [32115] Other proteins in same PDB: d1efua1, d1efua2, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc2, d1efud2, d1efud3, d1efud4 |
PDB Entry: 1efu (more details), 2.5 Å
SCOP Domain Sequences for d1efua3:
Sequence, based on SEQRES records: (download)
>d1efua3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
>d1efua3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper
Timeline for d1efua3: