Lineage for d5kdra_ (5kdr A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (60 species)
    not a true protein
  7. 2437204Species Staphylococcus aureus [TaxId:367830] [321148] (1 PDB entry)
  8. 2437205Domain d5kdra_: 5kdr A: [321149]
    automated match to d2f9ya1
    complexed with edo, so4, yt5, zn

Details for d5kdra_

PDB Entry: 5kdr (more details), 2.6 Å

PDB Description: the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b.
PDB Compounds: (A:) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha

SCOPe Domain Sequences for d5kdra_:

Sequence, based on SEQRES records: (download)

>d5kdra_ c.14.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
ldfekplfeirnkieslkesqdkndvdlqeeidmleasleretkkiytnlkpwdrvqiar
lqerpttldyipyifdsfmelhgdrnfrddpamiggigflngravtvigqqrgkdtkdni
yrnfgmahpegyrkalrlmkqaekfnrpiftfidtkgaypgkaaeergqsesiatnliem
aslkvpviaivigeggsggalgigiankvlmlenstysvispegaaallwkdsnlakiaa
etmkitahdikqlgiiddviseplggahkdieqqalaiksafvaqldsleslsrdeiand
rfekfrnigsyie

Sequence, based on observed residues (ATOM records): (download)

>d5kdra_ c.14.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
ldfekplfeirnkiesqeeidmleasleretkkiytnlkpwdrvqiarlqerpttldyip
yifdsfmelhgdrnfrddpamiggigflngravtvigqqrgkdtkdniyrnfgmahpegy
rkalrlmkqaekfnrpiftfidtkgaypgkaaeergqsesiatnliemaslkvpviaivi
geggsggalgigiankvlmlenstysvispegaaallwkdsnlakiaaetmkitahdikq
lgiiddviseplggahkdieqqalaiksafvaqldsleslsrdeiandrfekfrnigsyi
e

SCOPe Domain Coordinates for d5kdra_:

Click to download the PDB-style file with coordinates for d5kdra_.
(The format of our PDB-style files is described here.)

Timeline for d5kdra_: