![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5k59l2: 5k59 L:107-212 [321144] Other proteins in same PDB: d5k59a_, d5k59b_, d5k59c_, d5k59d_, d5k59e_, d5k59f1, d5k59h_, d5k59l1 automated match to d1dn0a2 complexed with cl, pg4, po4 |
PDB Entry: 5k59 (more details), 2.84 Å
SCOPe Domain Sequences for d5k59l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k59l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d5k59l2: