SCOPe 2.08: Domain d5lapa_: 5lap A:

Lineage for d5lapa_ (5lap A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)

8. Domain d5lapa_: 5lap A: [321140]
   automated match to d2feja_
   complexed with 6sm, zn; mutant

Details for d5lapa_

PDB Entry: 5lap, 1.42 Å

PDB Description: p53 cancer mutant y220c with cys182 alkylation

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d5lapa_:

Sequence; same for both SEQRES and ATOM records:

>d5lapa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr

Timeline for d5lapa_:

• d5lapa_ first appeared in SCOPe 2.06
  
• d5lapa_ appears in SCOPe 2.07