SCOPe 2.08: Domain d5l1ma2: 5l1m A:89-160

Lineage for d5l1ma2 (5l1m A:89-160)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d5l1ma2: 5l1m A:89-160 [321136]
   automated match to d4is7a2

Details for d5l1ma2

PDB Entry: 5l1m, 2.75 Å

PDB Description: caskin2 sam domain tandem

PDB Compounds: (A:) Caskin-2

SCOPe Domain Sequences for d5l1ma2:

Sequence; same for both SEQRES and ATOM records:

>d5l1ma2 a.60.1.0 (A:89-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psyiptdllewlcalglpqyhkqlvssgydsmglvadltweelqeigvnklghqkklmlg
vkrlaelrrgll

Timeline for d5l1ma2:

• d5l1ma2 first appeared in SCOPe 2.06
  
• d5l1ma2 appears in SCOPe 2.07