SCOPe 2.07: Domain d5kveh1: 5kve H:6-112

Lineage for d5kveh1 (5kve H:6-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d5kveh1: 5kve H:6-112 [321134]
   Other proteins in same PDB: d5kvee_, d5kveh2, d5kvel_
   automated match to d1a6wh_
   complexed with act, edo, na, so4

Details for d5kveh1

PDB Entry: 5kve, 1.7 Å

PDB Description: zika specific antibody, zv-48, bound to zika envelope diii

PDB Compounds: (H:) ZV-48 Antibody scFv Heavy chain

SCOPe Domain Sequences for d5kveh1:

Sequence; same for both SEQRES and ATOM records:

>d5kveh1 b.1.1.1 (H:6-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaellkpgasvklsckasgysfsnywmhwvkqrpgqgpewigmihpnsgntkynekfk
nkatltvdksssmvymqlssltsedsavfycarlgndmdywgqgtsvtvs

Timeline for d5kveh1:

• d5kveh1 first appeared in SCOPe 2.06, called d5kveh_
  
• d5kveh1 does not appear in SCOPe 2.08