Lineage for d5kvee_ (5kve E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765534Species Zika virus [TaxId:64320] [320471] (7 PDB entries)
  8. 2765538Domain d5kvee_: 5kve E: [321129]
    Other proteins in same PDB: d5kvel_
    automated match to d1s6na_
    complexed with act, edo, na, so4

Details for d5kvee_

PDB Entry: 5kve (more details), 1.7 Å

PDB Description: zika specific antibody, zv-48, bound to zika envelope diii
PDB Compounds: (E:) Genome polyprotein

SCOPe Domain Sequences for d5kvee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvee_ b.1.18.4 (E:) automated matches {Zika virus [TaxId: 64320]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrs

SCOPe Domain Coordinates for d5kvee_:

Click to download the PDB-style file with coordinates for d5kvee_.
(The format of our PDB-style files is described here.)

Timeline for d5kvee_: