Lineage for d5jxea_ (5jxe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741861Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2741862Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)
  8. 2741885Domain d5jxea_: 5jxe A: [321118]
    Other proteins in same PDB: d5jxec1, d5jxec2, d5jxef1, d5jxef2
    automated match to d4zqkb_

Details for d5jxea_

PDB Entry: 5jxe (more details), 2.9 Å

PDB Description: human pd-1 ectodomain complexed with pembrolizumab fab
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d5jxea_:

Sequence, based on SEQRES records: (download)

>d5jxea_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
pptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqds
rfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Sequence, based on observed residues (ATOM records): (download)

>d5jxea_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
pptfspallvvtegdnatftcvlnwyrmspsnqtdklaafpedrsqpgqdsrfrvtqlpn
grdfhmsvvrarrndsgtylcgaiskeslraelrvte

SCOPe Domain Coordinates for d5jxea_:

Click to download the PDB-style file with coordinates for d5jxea_.
(The format of our PDB-style files is described here.)

Timeline for d5jxea_: