![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries) |
![]() | Domain d5jxea_: 5jxe A: [321118] Other proteins in same PDB: d5jxec1, d5jxec2, d5jxef1, d5jxef2 automated match to d4zqkb_ |
PDB Entry: 5jxe (more details), 2.9 Å
SCOPe Domain Sequences for d5jxea_:
Sequence, based on SEQRES records: (download)
>d5jxea_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} pptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqds rfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte
>d5jxea_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} pptfspallvvtegdnatftcvlnwyrmspsnqtdklaafpedrsqpgqdsrfrvtqlpn grdfhmsvvrarrndsgtylcgaiskeslraelrvte
Timeline for d5jxea_: