Lineage for d5k82c_ (5k82 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525970Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2525996Protein APOBEC3G (ARCD) [310757] (2 species)
  7. 2526000Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [346337] (6 PDB entries)
  8. 2526025Domain d5k82c_: 5k82 C: [321115]
    automated match to d3vm8a_
    complexed with zn

Details for d5k82c_

PDB Entry: 5k82 (more details), 2.91 Å

PDB Description: crystal structure of a primate apobec3g n-terminal domain
PDB Compounds: (C:) Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G

SCOPe Domain Sequences for d5k82c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k82c_ c.97.1.6 (C:) APOBEC3G (ARCD) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkak
yhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarl
yyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqa
tlgellrh

SCOPe Domain Coordinates for d5k82c_:

Click to download the PDB-style file with coordinates for d5k82c_.
(The format of our PDB-style files is described here.)

Timeline for d5k82c_: