Lineage for d5ik4a2 (5ik4 A:2933-3118)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) Protein automated matches [190380] (3 species)
not a true proteinSpecies Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries) 
Domain d5ik4a2: 5ik4 A:2933-3118 [321114]
automated match to d1okqa2
complexed with a2g, ca, gol, nag
Details for d5ik4a2
PDB Entry: 5ik4 (more details), 1.27 Å
PDB Description: laminin a2lg45 c-form, apo.
PDB Compounds: (A:) laminin subunit alpha-2SCOPe Domain Sequences for d5ik4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik4a2 b.29.1.4 (A:2933-3118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscptt
SCOPe Domain Coordinates for d5ik4a2:
Click to download the PDB-style file with coordinates for d5ik4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ik4a2:
- d5ik4a2 first appeared in SCOPe 2.06
- d5ik4a2 appears in SCOPe 2.07
View in 3D
