| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
| Protein automated matches [190380] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries) |
| Domain d5ik4a2: 5ik4 A:2933-3118 [321114] automated match to d1okqa2 complexed with a2g, ca, gol, nag |
PDB Entry: 5ik4 (more details), 1.27 Å
SCOPe Domain Sequences for d5ik4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik4a2 b.29.1.4 (A:2933-3118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscptt
Timeline for d5ik4a2: