Lineage for d1agra2 (1agr A:5-60,A:182-354)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846866Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1846915Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 1846931Domain d1agra2: 1agr A:5-60,A:182-354 [32111]
    Other proteins in same PDB: d1agra1, d1agrd1, d1agre_, d1agrh_
    complexed with alf, cit, gdp, mg

Details for d1agra2

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4
PDB Compounds: (A:) guanine nucleotide-binding protein g(I)

SCOPe Domain Sequences for d1agra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agra2 c.37.1.8 (A:5-60,A:182-354) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi
vethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

SCOPe Domain Coordinates for d1agra2:

Click to download the PDB-style file with coordinates for d1agra2.
(The format of our PDB-style files is described here.)

Timeline for d1agra2: