SCOPe 2.08: Domain d5joya2: 5joy A:323-521

Lineage for d5joya2 (5joy A:323-521)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)

8. Domain d5joya2: 5joy A:323-521 [321109]
   Other proteins in same PDB: d5joya1, d5joya3, d5joyb1
   automated match to d1yrza1
   complexed with 6lw, edo, trs

Details for d5joya2

PDB Entry: 5joy, 1.9 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a in complex with aralog

PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5joya2:

Sequence; same for both SEQRES and ATOM records:

>d5joya2 b.29.1.0 (A:323-521) automated matches {Bacteroides ovatus [TaxId: 28116]}
rperidfkegklspewihlqnpeaknyiftkdgklrliatpvtlsdwksptfvalrqehf
dmeasapvvlqkagvndeagisvfmefhshydlfvrqdkdrkrsvglryklgeithyake
vslptdgevelvvksdinyyyfgykvngiyhdlgkmntrylstetaggftgvvlglyits
askdskayadfeyfkykgk

Timeline for d5joya2:

• d5joya2 first appeared in SCOPe 2.06
  
• d5joya2 appears in SCOPe 2.07