SCOPe 2.07: Domain d5joya1: 5joy A:21-322

Lineage for d5joya1 (5joy A:21-322)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries)

8. Domain d5joya1: 5joy A:21-322 [321108]
   Other proteins in same PDB: d5joya2, d5joya3, d5joyb2
   automated match to d1yrza2
   complexed with 6lw, edo, trs

Details for d5joya1

PDB Entry: 5joy, 1.9 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a in complex with aralog

PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5joya1:

Sequence; same for both SEQRES and ATOM records:

>d5joya1 b.67.2.0 (A:21-322) automated matches {Bacteroides ovatus [TaxId: 28116]}
qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq
ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid
pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy
ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt
dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem
kg

Timeline for d5joya1:

• d5joya1 first appeared in SCOPe 2.06
  
• d5joya1 appears in the current release, SCOPe 2.08