Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.0: automated matches [227228] (1 protein) not a true family |
Protein automated matches [226971] (7 species) not a true protein |
Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries) |
Domain d5joya1: 5joy A:21-322 [321108] Other proteins in same PDB: d5joya2, d5joya3, d5joyb2 automated match to d1yrza2 complexed with 6lw, edo, trs |
PDB Entry: 5joy (more details), 1.9 Å
SCOPe Domain Sequences for d5joya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5joya1 b.67.2.0 (A:21-322) automated matches {Bacteroides ovatus [TaxId: 28116]} qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem kg
Timeline for d5joya1: