Lineage for d5joya1 (5joy A:21-322)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807514Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2807515Protein automated matches [226971] (7 species)
    not a true protein
  7. 2807531Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries)
  8. 2807532Domain d5joya1: 5joy A:21-322 [321108]
    Other proteins in same PDB: d5joya2, d5joya3, d5joyb2
    automated match to d1yrza2
    complexed with 6lw, edo, trs

Details for d5joya1

PDB Entry: 5joy (more details), 1.9 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a in complex with aralog
PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5joya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5joya1 b.67.2.0 (A:21-322) automated matches {Bacteroides ovatus [TaxId: 28116]}
qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq
ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid
pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy
ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt
dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem
kg

SCOPe Domain Coordinates for d5joya1:

Click to download the PDB-style file with coordinates for d5joya1.
(The format of our PDB-style files is described here.)

Timeline for d5joya1: