SCOPe 2.06: Domain d5jpaa2: 5jpa A:148-219

Lineage for d5jpaa2 (5jpa A:148-219)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (4 PDB entries)

8. Domain d5jpaa2: 5jpa A:148-219 [321102]
   Other proteins in same PDB: d5jpaa1
   automated match to d2m8pa2
   mutant

Details for d5jpaa2

PDB Entry: 5jpa, 1.7 Å

PDB Description: hexameric hiv-1 ca h12y mutant

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5jpaa2:

Sequence, based on SEQRES records:

>d5jpaa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d5jpaa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqastetllvqnanpdcktilkalgpgatleem
mtacq

Timeline for d5jpaa2:

• d5jpaa2 is new in SCOPe 2.06-stable
  
• d5jpaa2 appears in SCOPe 2.07
  
• d5jpaa2 appears in the current release, SCOPe 2.08