![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
![]() | Protein automated matches [190380] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries) |
![]() | Domain d5ik5a1: 5ik5 A:2740-2932 [321097] automated match to d1dyka1 complexed with 4mu, ca, gol |
PDB Entry: 5ik5 (more details), 1.39 Å
SCOPe Domain Sequences for d5ik5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik5a1 b.29.1.4 (A:2740-2932) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ptmvhgpcvaesepalltgskqfglsrnshiaiafddtkvknrltielevrteaesgllf ymarinhadfatvqlrngfpyfsydlgsgdtstmiptkindgqwhkikivrvkqegilyv ddassqtispkkadildvvgilyvgglpinyttrrigpvtysldgcvrnlhmeqapvdld qptssfhvgtcfa
Timeline for d5ik5a1: