SCOPe 2.08: Domain d5da5b1: 5da5 B:7-96

Lineage for d5da5b1 (5da5 B:7-96)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries)

8. Domain d5da5b1: 5da5 B:7-96 [321091]
   Other proteins in same PDB: d5da5a2, d5da5b2, d5da5d2, d5da5f2, d5da5g2, d5da5h2, d5da5i2, d5da5j2, d5da5k2, d5da5l2, d5da5n2, d5da5p2, d5da5t2, d5da5u2
   automated match to d1zpyg_
   complexed with ca, fe, goa

Details for d5da5b1

PDB Entry: 5da5, 2.06 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973

PDB Compounds: (B:) Rru_A0973

SCOPe Domain Sequences for d5da5b1:

Sequence; same for both SEQRES and ATOM records:

>d5da5b1 a.25.1.0 (B:7-96) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
amtlewlrrndakwaehlrtylftegpita

Timeline for d5da5b1:

• d5da5b1 first appeared in SCOPe 2.06
  
• d5da5b1 appears in SCOPe 2.07