Lineage for d1gg2a2 (1gg2 A:5-60,A:182-348)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179695Protein Transducin (alpha subunit) [52623] (2 species)
  7. 179713Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)
  8. 179724Domain d1gg2a2: 1gg2 A:5-60,A:182-348 [32109]
    Other proteins in same PDB: d1gg2a1, d1gg2b_, d1gg2g_

Details for d1gg2a2

PDB Entry: 1gg2 (more details), 2.4 Å

PDB Description: g protein heterotrimer mutant gi_alpha_1(g203a) beta_1 gamma_2 with gdp bound

SCOP Domain Sequences for d1gg2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gg2a2 c.37.1.8 (A:5-60,A:182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi
vethftfkdlhfkmfdvgaqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnl

SCOP Domain Coordinates for d1gg2a2:

Click to download the PDB-style file with coordinates for d1gg2a2.
(The format of our PDB-style files is described here.)

Timeline for d1gg2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gg2a1