SCOPe 2.06: Domain d5jneh2: 5jne H:127-256

Lineage for d5jneh2 (5jne H:127-256)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (2 PDB entries)

8. Domain d5jneh2: 5jne H:127-256 [321086]
   Other proteins in same PDB: d5jneb1, d5jneb2, d5jnec_, d5jnef_, d5jneg_
   automated match to d1plqa2
   complexed with 6ln, gol, zn

Details for d5jneh2

PDB Entry: 5jne, 2.85 Å

PDB Description: e2-sumo-siz1 e3-sumo-pcna complex

PDB Compounds: (H:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5jneh2:

Sequence; same for both SEQRES and ATOM records:

>d5jneh2 d.131.1.2 (H:127-256) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gieelqydstlslpssefskivrdlsqlsdsinimitcetikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd

Timeline for d5jneh2:

• d5jneh2 is new in SCOPe 2.06-stable
  
• d5jneh2 appears in SCOPe 2.07
  
• d5jneh2 appears in the current release, SCOPe 2.08