SCOP 1.63: Domain d1gp2a2: 1gp2 A:5-60,A:182-348

Lineage for d1gp2a2 (1gp2 A:5-60,A:182-348)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)

8. Domain d1gp2a2: 1gp2 A:5-60,A:182-348 [32108]
   Other proteins in same PDB: d1gp2a1, d1gp2b_, d1gp2g_
   complexed with gdp; mutant

Details for d1gp2a2

PDB Entry: 1gp2, 2.3 Å

PDB Description: g protein heterotrimer gi_alpha_1 beta_1 gamma_2 with gdp bound

SCOP Domain Sequences for d1gp2a2:

Sequence; same for both SEQRES and ATOM records:

>d1gp2a2 c.37.1.8 (A:5-60,A:182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi
vethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnl

Timeline for d1gp2a2:

• d1gp2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1gp2a2 appears in SCOP 1.61
  
• d1gp2a2 appears in SCOP 1.65
  
• d1gp2a2 appears in the current release, SCOPe 2.08