SCOPe 2.08: Domain d5joza2: 5joz A:328-529

Lineage for d5joza2 (5joz A:328-529)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)

8. Domain d5joza2: 5joz A:328-529 [321076]
   Other proteins in same PDB: d5joza1, d5joza3, d5jozb1
   automated match to d3c2ub2
   complexed with ca

Details for d5joza2

PDB Entry: 5joz, 2.28 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43b

PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43B

SCOPe Domain Sequences for d5joza2:

Sequence; same for both SEQRES and ATOM records:

>d5joza2 b.29.1.0 (A:328-529) automated matches {Bacteroides ovatus [TaxId: 28116]}
meqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsfigrrq
aafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkdkvvdt
tckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvfigmya
sgngqantnpadfdwfdfrcld

Timeline for d5joza2:

• d5joza2 first appeared in SCOPe 2.06
  
• d5joza2 appears in SCOPe 2.07