Class b: All beta proteins [48724] (178 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.0: automated matches [227228] (1 protein) not a true family |
Protein automated matches [226971] (7 species) not a true protein |
Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries) |
Domain d5joza1: 5joz A:25-327 [321075] Other proteins in same PDB: d5joza2, d5joza3, d5jozb2 automated match to d3c2ua1 complexed with ca |
PDB Entry: 5joz (more details), 2.28 Å
SCOPe Domain Sequences for d5joza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5joza1 b.67.2.0 (A:25-327) automated matches {Bacteroides ovatus [TaxId: 28116]} ktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrpen nplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwvgn wyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphfyk igdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighadlv qlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnlps hvw
Timeline for d5joza1: