Lineage for d5joza1 (5joz A:25-327)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (5 species)
    not a true protein
  7. 2398166Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries)
  8. 2398171Domain d5joza1: 5joz A:25-327 [321075]
    Other proteins in same PDB: d5joza2, d5joza3, d5jozb2
    automated match to d3c2ua1
    complexed with ca

Details for d5joza1

PDB Entry: 5joz (more details), 2.28 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43b
PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43B

SCOPe Domain Sequences for d5joza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5joza1 b.67.2.0 (A:25-327) automated matches {Bacteroides ovatus [TaxId: 28116]}
ktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrpen
nplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwvgn
wyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphfyk
igdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighadlv
qlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnlps
hvw

SCOPe Domain Coordinates for d5joza1:

Click to download the PDB-style file with coordinates for d5joza1.
(The format of our PDB-style files is described here.)

Timeline for d5joza1: