Lineage for d1as3_2 (1as3 9-60,182-354)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313840Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 313858Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)
  8. 313868Domain d1as3_2: 1as3 9-60,182-354 [32107]
    Other proteins in same PDB: d1as3_1
    complexed with gdp, so4; mutant

Details for d1as3_2

PDB Entry: 1as3 (more details), 2.4 Å

PDB Description: gdp bound g42v gia1

SCOP Domain Sequences for d1as3_2:

Sequence, based on SEQRES records: (download)

>d1as3_2 c.37.1.8 (9-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
dkaaverskmidrnlredgekaarevkllllgavesgkstivkqmkiiheagXtgiveth
ftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmk
lfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfe
dlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records): (download)

>d1as3_2 c.37.1.8 (9-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
dkaaverskmidrnlredgekaarevkllllgavesgkstivkqmkiiheagXtgiveth
ftfkdlhfkmfdvggqfegvtaiifcvalsdydlvmnrmhesmklfdsicnnkwftdtsi
ilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythft
catdtknvqfvfdavtdviiknnlkdcglf

SCOP Domain Coordinates for d1as3_2:

Click to download the PDB-style file with coordinates for d1as3_2.
(The format of our PDB-style files is described here.)

Timeline for d1as3_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1as3_1