Lineage for d5jozb2 (5joz B:328-528)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 2375175Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)
  8. 2375185Domain d5jozb2: 5joz B:328-528 [321067]
    Other proteins in same PDB: d5joza1, d5joza3, d5jozb1
    automated match to d3c2ub2
    complexed with ca

Details for d5jozb2

PDB Entry: 5joz (more details), 2.28 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43b
PDB Compounds: (B:) Non-reducing end alpha-L-arabinofuranosidase BoGH43B

SCOPe Domain Sequences for d5jozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jozb2 b.29.1.0 (B:328-528) automated matches {Bacteroides ovatus [TaxId: 28116]}
meqpvrddfdqetlgldwtfirnpahsfwsltekpgslrlkgtainfttndspsfigrrq
aafnltasakvnfipkveneeaglvvraddknhydlliterngqrvamirktlkdkvvdt
tckelpatgevilsitatettytfeikaahvsailgtastrdvsnevvggftgvfigmya
sgngqantnpadfdwfdfrcl

SCOPe Domain Coordinates for d5jozb2:

Click to download the PDB-style file with coordinates for d5jozb2.
(The format of our PDB-style files is described here.)

Timeline for d5jozb2: