Lineage for d5jozb1 (5joz B:25-327)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074534Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2074544Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2074711Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2074712Protein automated matches [226971] (3 species)
    not a true protein
  7. 2074713Species Bacteroides ovatus [TaxId:28116] [321064] (3 PDB entries)
  8. 2074719Domain d5jozb1: 5joz B:25-327 [321065]
    Other proteins in same PDB: d5joza2, d5joza3, d5jozb2
    automated match to d3c2ua1
    complexed with ca

Details for d5jozb1

PDB Entry: 5joz (more details), 2.28 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43b
PDB Compounds: (B:) Non-reducing end alpha-L-arabinofuranosidase BoGH43B

SCOPe Domain Sequences for d5jozb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jozb1 b.67.2.0 (B:25-327) automated matches {Bacteroides ovatus [TaxId: 28116]}
ktfrnpiitgmnpdpsicrvgddfylvtstfeyfpglpvyhskdlvhwklighalsrpen
nplmgcnastggqyaptlryhdgtfyvigtnyggkgsqgvfyvtaknpagpwsdpvwvgn
wyvdpsiefidgkmyflspdnqgsfllgvmdpetgtfvealrkvasglggsspegphfyk
igdyyyimsaeggtgyehreviqrskspwgpyepspvnpvlsnmncpdhpfqaighadlv
qlkdgswwavclgirpvngkyqhlgretflapvtwdadgwpkvgkdgvvqetylfpnlps
hvw

SCOPe Domain Coordinates for d5jozb1:

Click to download the PDB-style file with coordinates for d5jozb1.
(The format of our PDB-style files is described here.)

Timeline for d5jozb1: