Lineage for d5jneb1 (5jne B:1-156)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184045Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (4 PDB entries)
  8. 2184049Domain d5jneb1: 5jne B:1-156 [321062]
    Other proteins in same PDB: d5jneb2, d5jnec_, d5jned1, d5jned2, d5jneg_, d5jneh1, d5jneh2
    automated match to d1u9aa_
    complexed with 6ln, gol, zn

Details for d5jneb1

PDB Entry: 5jne (more details), 2.85 Å

PDB Description: e2-sumo-siz1 e3-sumo-pcna complex
PDB Compounds: (B:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d5jneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jneb1 d.20.1.1 (B:1-156) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msslslqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypi
tveypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdll
dspnpnspkqepawrsfsrnkaeydkkvllqarqys

SCOPe Domain Coordinates for d5jneb1:

Click to download the PDB-style file with coordinates for d5jneb1.
(The format of our PDB-style files is described here.)

Timeline for d5jneb1: