SCOPe 2.08: Domain d1gila2: 1gil A:34-60,A:182-343

Lineage for d1gila2 (1gil A:34-60,A:182-343)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1gila2: 1gil A:34-60,A:182-343 [32106]
   Other proteins in same PDB: d1gila1
   complexed with gsp, mg
   has additional subdomain(s) that are not in the common domain

Details for d1gila2

PDB Entry: 1gil, 2.3 Å

PDB Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis

PDB Compounds: (A:) g protein gi alpha 1

SCOPe Domain Sequences for d1gila2:

Sequence; same for both SEQRES and ATOM records:

>d1gila2 c.37.1.8 (A:34-60,A:182-343) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvgglrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvi

Timeline for d1gila2:

• d1gila2 first appeared (with stable ids) in SCOP 1.55, called d1gil_2
  
• d1gila2 appears in SCOPe 2.07