Lineage for d5jq9b1 (5jq9 B:1-276)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425526Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2425527Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2425632Protein automated matches [194480] (7 species)
    not a true protein
  7. 2425656Species Yersinia pestis [TaxId:687916] [321048] (1 PDB entry)
  8. 2425658Domain d5jq9b1: 5jq9 B:1-276 [321050]
    Other proteins in same PDB: d5jq9b2
    automated match to d3tyzb_
    complexed with 6mb, edo

Details for d5jq9b1

PDB Entry: 5jq9 (more details), 2.1 Å

PDB Description: yersinia pestis dhps with pterine-sulfa conjugate compound 16
PDB Compounds: (B:) dihydropteroate synthase

SCOPe Domain Sequences for d5jq9b1:

Sequence, based on SEQRES records: (download)

>d5jq9b1 c.1.21.1 (B:1-276) automated matches {Yersinia pestis [TaxId: 687916]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsak

Sequence, based on observed residues (ATOM records): (download)

>d5jq9b1 c.1.21.1 (B:1-276) automated matches {Yersinia pestis [TaxId: 687916]}
mhltargltldlsrpqvmgilnvtnldqalqhaqrmlsagatlidiggestevseqeeld
rvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqepgaleaaaktglpv
clmhmqpyyddlmtdinrffqhhiercvaagiaknkllldpgfgfgknlahnyqllahls
elhhfelpllvgmsrksmvgqllnvppqqrvigsvacaviaamqgaqiirvhdvketvea
mciveatrsak

SCOPe Domain Coordinates for d5jq9b1:

Click to download the PDB-style file with coordinates for d5jq9b1.
(The format of our PDB-style files is described here.)

Timeline for d5jq9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jq9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jq9a_