SCOP 1.73: Domain d1gita2: 1git A:32-60,A:182-348

Lineage for d1gita2 (1git A:32-60,A:182-348)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (3 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries)

8. Domain d1gita2: 1git A:32-60,A:182-348 [32105]
   Other proteins in same PDB: d1gita1
   complexed with gdp, po4; mutant

Details for d1gita2

PDB Entry: 1git, 2.6 Å

PDB Description: structure of gtp-binding protein

PDB Compounds: (A:) g protein gi alpha 1

SCOP Domain Sequences for d1gita2:

Sequence; same for both SEQRES and ATOM records:

>d1gita2 c.37.1.8 (A:32-60,A:182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvgaqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknnl

Timeline for d1gita2:

• d1gita2 first appeared (with stable ids) in SCOP 1.55, called d1git_2
  
• d1gita2 was called d1git_2 in SCOP 1.71
  
• d1gita2 appears in SCOP 1.75
  
• d1gita2 appears in the current release, SCOPe 2.08