Lineage for d1git_2 (1git 32-60,182-348)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Transducin (alpha subunit) [52623] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) 
Domain d1git_2: 1git 32-60,182-348 [32105]
Other proteins in same PDB: d1git_1
Details for d1git_2
PDB Entry: 1git (more details), 2.6 Å
PDB Description: structure of gtp-binding protein
SCOP Domain Sequences for d1git_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1git_2 c.37.1.8 (32-60,182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvgaqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknnl
SCOP Domain Coordinates for d1git_2:
Click to download the PDB-style file with coordinates for d1git_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1git_2:
- d1git_2 appears in SCOP 1.57
- d1git_2 appears in the current release, SCOPe 2.08, called d1gita2
View in 3D
