SCOPe 2.08: Domain d5jowa2: 5jow A:323-522

Lineage for d5jowa2 (5jow A:323-522)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:411476] [321042] (1 PDB entry)

8. Domain d5jowa2: 5jow A:323-522 [321043]
   Other proteins in same PDB: d5jowa1, d5jowa3, d5jowb1, d5jowb3
   automated match to d1yrza1
   complexed with edo, trs

Details for d5jowa2

PDB Entry: 5jow, 1.6 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a

PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5jowa2:

Sequence; same for both SEQRES and ATOM records:

>d5jowa2 b.29.1.0 (A:323-522) automated matches {Bacteroides ovatus [TaxId: 411476]}
rperidfkegklspewihlqnpeaknyiftkdgklrliatpvtlsdwksptfvalrqehf
dmeasapvvlqkagvndeagisvfmefhshydlfvrqdkdrkrsvglryklgeithyake
vslptdgevelvvksdinyyyfgykvngiyhdlgkmntrylstetaggftgvvlglyits
askdskayadfeyfkykgkp

Timeline for d5jowa2:

• d5jowa2 first appeared in SCOPe 2.06
  
• d5jowa2 appears in SCOPe 2.07