Lineage for d5jowa1 (5jow A:21-322)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (7 species)
    not a true protein
  7. 2398173Species Bacteroides ovatus [TaxId:411476] [321040] (1 PDB entry)
  8. 2398174Domain d5jowa1: 5jow A:21-322 [321041]
    Other proteins in same PDB: d5jowa2, d5jowa3, d5jowb2, d5jowb3
    automated match to d1yrza2
    complexed with edo, trs

Details for d5jowa1

PDB Entry: 5jow (more details), 1.6 Å

PDB Description: bacteroides ovatus xyloglucan pul gh43a
PDB Compounds: (A:) Non-reducing end alpha-L-arabinofuranosidase BoGH43A

SCOPe Domain Sequences for d5jowa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jowa1 b.67.2.0 (A:21-322) automated matches {Bacteroides ovatus [TaxId: 411476]}
qgysnpvipgfhpdpsvckagddyylvnssfqyfpgvplfhskdlvhweqigncltrpsq
ldltnansgsgifaptiryndgvfymittnvsgkgnflvhttdprsewsepvwleqggid
pslyfedgkcfmvsnpdgyinlceidpmtgkqlssskriwngtggryaegphiykkdgwy
ylliseggtelghkvtiarsryidgpyqgnpanpilthanesgqsspiqgtghadlvegt
dgswwmvclayrimpgthhtlgretylapvrwdkdawpvvnsngtislkmdvptlpqqem
kg

SCOPe Domain Coordinates for d5jowa1:

Click to download the PDB-style file with coordinates for d5jowa1.
(The format of our PDB-style files is described here.)

Timeline for d5jowa1: