Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries) Uniprot P10824 |
Domain d1fqkc2: 1fqk C:29-60,C:182-345 [32104] Other proteins in same PDB: d1fqka1, d1fqkb_, d1fqkc1, d1fqkd_ species chimera complexed with alf, gdp, mg |
PDB Entry: 1fqk (more details), 2.3 Å
SCOPe Domain Sequences for d1fqkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqkc2 c.37.1.8 (C:29-60,C:182-345) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]} tvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkwi hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd lfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqnv kfvfdavtdiiikenlk
Timeline for d1fqkc2:
View in 3D Domains from other chains: (mouse over for more information) d1fqka1, d1fqka2, d1fqkb_, d1fqkd_ |