![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein HIV-1 capsid protein [47945] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (64 PDB entries) |
![]() | Domain d5hgkb_: 5hgk B: [321039] automated match to d1m9cc_ complexed with cl |
PDB Entry: 5hgk (more details), 1.76 Å
SCOPe Domain Sequences for d5hgkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hgkb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmys
Timeline for d5hgkb_: