Lineage for d5hgkb_ (5hgk B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717904Domain d5hgkb_: 5hgk B: [321039]
    automated match to d1m9cc_
    complexed with cl

Details for d5hgkb_

PDB Entry: 5hgk (more details), 1.76 Å

PDB Description: hiv-1 ca n-terminal domain, open conformation
PDB Compounds: (B:) capsid protein

SCOPe Domain Sequences for d5hgkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hgkb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d5hgkb_:

Click to download the PDB-style file with coordinates for d5hgkb_.
(The format of our PDB-style files is described here.)

Timeline for d5hgkb_: