| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (12 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (32 PDB entries) |
| Domain d5hglc2: 5hgl C:148-219 [321036] Other proteins in same PDB: d5hgla1, d5hglb1, d5hglc1, d5hgld1, d5hgle1, d5hglf1 automated match to d2m8pa2 complexed with 1b0, cl |
PDB Entry: 5hgl (more details), 3.1 Å
SCOPe Domain Sequences for d5hglc2:
Sequence, based on SEQRES records: (download)
>d5hglc2 a.28.3.0 (C:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
>d5hglc2 a.28.3.0 (C:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraetetllvqnanpdcktilkalgpgatleemmta
cq
Timeline for d5hglc2: