SCOPe 2.08: Domain d5ik7a2: 5ik7 A:2933-3118

Lineage for d5ik7a2 (5ik7 A:2933-3118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein automated matches [190380] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries)

8. Domain d5ik7a2: 5ik7 A:2933-3118 [321029]
   Other proteins in same PDB: d5ik7a3, d5ik7b3
   automated match to d1okqa2
   complexed with ca, edo, flc, nag

Details for d5ik7a2

PDB Entry: 5ik7, 2 Å

PDB Description: laminin a2lg45 i-form, apo.

PDB Compounds: (A:) laminin subunit alpha-2

SCOPe Domain Sequences for d5ik7a2:

Sequence; same for both SEQRES and ATOM records:

>d5ik7a2 b.29.1.4 (A:2933-3118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscptt

Timeline for d5ik7a2:

• d5ik7a2 first appeared in SCOPe 2.06
  
• d5ik7a2 appears in SCOPe 2.07