Lineage for d5ik7b2 (5ik7 B:2933-3118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779614Protein automated matches [190380] (3 species)
    not a true protein
  7. 2779620Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries)
  8. 2779636Domain d5ik7b2: 5ik7 B:2933-3118 [321026]
    Other proteins in same PDB: d5ik7a3, d5ik7b3
    automated match to d1okqa2
    complexed with ca, edo, flc, nag

Details for d5ik7b2

PDB Entry: 5ik7 (more details), 2 Å

PDB Description: laminin a2lg45 i-form, apo.
PDB Compounds: (B:) laminin subunit alpha-2

SCOPe Domain Sequences for d5ik7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik7b2 b.29.1.4 (B:2933-3118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscptt

SCOPe Domain Coordinates for d5ik7b2:

Click to download the PDB-style file with coordinates for d5ik7b2.
(The format of our PDB-style files is described here.)

Timeline for d5ik7b2: