| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
| Protein automated matches [190380] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries) |
| Domain d5ik7b1: 5ik7 B:2742-2932 [321025] Other proteins in same PDB: d5ik7a3, d5ik7b3 automated match to d1dyka1 complexed with ca, edo, flc, nag |
PDB Entry: 5ik7 (more details), 2 Å
SCOPe Domain Sequences for d5ik7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik7b1 b.29.1.4 (B:2742-2932) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvhgpcvaesepalltgskqfglsrnshiaiafddtkvknrltielevrteaesgllfym
arinhadfatvqlrngfpyfsydlgsgdtstmiptkindgqwhkikivrvkqegilyvdd
assqtispkkadildvvgilyvgglpinyttrrigpvtysldgcvrnlhmeqapvdldqp
tssfhvgtcfa
Timeline for d5ik7b1: