SCOPe 2.08: Domain d5hgma2: 5hgm A:148-219

Lineage for d5hgma2 (5hgm A:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d5hgma2: 5hgm A:148-219 [321024]
   Other proteins in same PDB: d5hgma1
   automated match to d2m8pa2
   complexed with dtp

Details for d5hgma2

PDB Entry: 5hgm, 2.04 Å

PDB Description: hexameric hiv-1 ca in complex with datp

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgma2:

Sequence, based on SEQRES records:

>d5hgma2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d5hgma2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q

Timeline for d5hgma2:

• d5hgma2 first appeared in SCOPe 2.06
  
• d5hgma2 appears in SCOPe 2.07