Lineage for d5hgma1 (5hgm A:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003180Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2003181Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2003182Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2003221Protein HIV-1 capsid protein [47945] (1 species)
  7. 2003222Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2003280Domain d5hgma1: 5hgm A:1-147 [321023]
    Other proteins in same PDB: d5hgma2
    automated match to d4xfxa1
    complexed with dtp

Details for d5hgma1

PDB Entry: 5hgm (more details), 2.04 Å

PDB Description: hexameric hiv-1 ca in complex with datp
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgma1:

Sequence, based on SEQRES records: (download)

>d5hgma1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d5hgma1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
aamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d5hgma1:

Click to download the PDB-style file with coordinates for d5hgma1.
(The format of our PDB-style files is described here.)

Timeline for d5hgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgma2