| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
| Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries) |
| Domain d1gfi_2: 1gfi 33-60,182-345 [32102] Other proteins in same PDB: d1gfi_1 complexed with alf, gdp, mg |
PDB Entry: 1gfi (more details), 2.2 Å
SCOP Domain Sequences for d1gfi_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfi_2 c.37.1.8 (33-60,182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik
Timeline for d1gfi_2: