SCOPe 2.08: Domain d5hgle1: 5hgl E:1-147

Lineage for d5hgle1 (5hgl E:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d5hgle1: 5hgl E:1-147 [321019]
   Other proteins in same PDB: d5hgla2, d5hglb2, d5hglc2, d5hgld2, d5hgle2, d5hglf2
   automated match to d4xfxa1
   complexed with 1b0, cl

Details for d5hgle1

PDB Entry: 5hgl, 3.1 Å

PDB Description: hexameric hiv-1 ca, open conformation

PDB Compounds: (E:) capsid protein p24

SCOPe Domain Sequences for d5hgle1:

Sequence, based on SEQRES records:

>d5hgle1 a.73.1.1 (E:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d5hgle1 a.73.1.1 (E:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge
iykrwiilglnkivrmysp

Timeline for d5hgle1:

• d5hgle1 first appeared in SCOPe 2.06
  
• d5hgle1 appears in SCOPe 2.07