![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
![]() | Protein automated matches [191156] (10 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (8 PDB entries) |
![]() | Domain d5hgla2: 5hgl A:148-219 [321006] Other proteins in same PDB: d5hgla1, d5hglb1, d5hglc1, d5hgld1, d5hgle1, d5hglf1 automated match to d2m8pa2 complexed with 1b0, cl |
PDB Entry: 5hgl (more details), 3.1 Å
SCOPe Domain Sequences for d5hgla2:
Sequence, based on SEQRES records: (download)
>d5hgla2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp gatleemmtacq
>d5hgla2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqeatetllvqnanpdcktilkalgpgatl eemmtacq
Timeline for d5hgla2: