Lineage for d5hgla2 (5hgl A:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706577Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. 2706626Domain d5hgla2: 5hgl A:148-219 [321006]
    Other proteins in same PDB: d5hgla1, d5hglb1, d5hglc1, d5hgld1, d5hgle1, d5hglf1
    automated match to d2m8pa2
    complexed with 1b0, cl

Details for d5hgla2

PDB Entry: 5hgl (more details), 3.1 Å

PDB Description: hexameric hiv-1 ca, open conformation
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgla2:

Sequence, based on SEQRES records: (download)

>d5hgla2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d5hgla2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqeatetllvqnanpdcktilkalgpgatl
eemmtacq

SCOPe Domain Coordinates for d5hgla2:

Click to download the PDB-style file with coordinates for d5hgla2.
(The format of our PDB-style files is described here.)

Timeline for d5hgla2: