SCOPe 2.06: Domain d5hgla1: 5hgl A:1-147

Lineage for d5hgla1 (5hgl A:1-147)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d5hgla1: 5hgl A:1-147 [321005]
   Other proteins in same PDB: d5hgla2, d5hglb2, d5hglc2, d5hgld2, d5hgle2, d5hglf2
   automated match to d4xfxa1
   complexed with 1b0, cl

Details for d5hgla1

PDB Entry: 5hgl, 3.1 Å

PDB Description: hexameric hiv-1 ca, open conformation

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgla1:

Sequence, based on SEQRES records:

>d5hgla1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d5hgla1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge
iykrwiilglnkivrmysp

Timeline for d5hgla1:

• d5hgla1 is new in SCOPe 2.06-stable
  
• d5hgla1 appears in SCOPe 2.07
  
• d5hgla1 appears in the current release, SCOPe 2.08