Lineage for d1bof_2 (1bof 10-60,182-354)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582325Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 582345Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries)
  8. 582352Domain d1bof_2: 1bof 10-60,182-354 [32100]
    Other proteins in same PDB: d1bof_1
    complexed with gdp, mg, so4

Details for d1bof_2

PDB Entry: 1bof (more details), 2.2 Å

PDB Description: gi-alpha-1 bound to gdp and magnesium

SCOP Domain Sequences for d1bof_2:

Sequence, based on SEQRES records: (download)

>d1bof_2 c.37.1.8 (10-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethf
tfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfed
lnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records): (download)

>d1bof_2 c.37.1.8 (10-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethf
tfkdlhfkmfdvggvtaiifcvalsdydlmnrmhesmklfdsicnnkwftdtsiilflnk
kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
nvqfvfdavtdviiknnlkdcglf

SCOP Domain Coordinates for d1bof_2:

Click to download the PDB-style file with coordinates for d1bof_2.
(The format of our PDB-style files is described here.)

Timeline for d1bof_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bof_1