SCOP 1.71: Domain d1bof_2: 1bof 10-60,182-354

Lineage for d1bof_2 (1bof 10-60,182-354)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries)

8. Domain d1bof_2: 1bof 10-60,182-354 [32100]
   Other proteins in same PDB: d1bof_1
   complexed with gdp, mg, so4

Details for d1bof_2

PDB Entry: 1bof, 2.2 Å

PDB Description: gi-alpha-1 bound to gdp and magnesium

SCOP Domain Sequences for d1bof_2:

Sequence, based on SEQRES records:

>d1bof_2 c.37.1.8 (10-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethf
tfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfed
lnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records):

>d1bof_2 c.37.1.8 (10-60,182-354) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivethf
tfkdlhfkmfdvggvtaiifcvalsdydlmnrmhesmklfdsicnnkwftdtsiilflnk
kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
nvqfvfdavtdviiknnlkdcglf

Timeline for d1bof_2:

• d1bof_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bof_2 appears in SCOP 1.69
  
• d1bof_2 is called d1bofa2 in SCOP 1.73
  
• d1bof_2 appears in the current release, SCOPe 2.08, called d1bofa2