Lineage for d5d15b1 (5d15 B:106-271)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561717Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2561718Protein automated matches [191274] (13 species)
    not a true protein
  7. 2561754Species Mycobacterium avium [TaxId:1391991] [320949] (4 PDB entries)
  8. 2561758Domain d5d15b1: 5d15 B:106-271 [320994]
    Other proteins in same PDB: d5d15a2, d5d15b2
    automated match to d2w01c_
    complexed with atp, ca, edo

Details for d5d15b1

PDB Entry: 5d15 (more details), 1.5 Å

PDB Description: crystal structure of an adenylyl cyclase ma1120 from mycobacterium avium in complex with atp and calcium ion
PDB Compounds: (B:) Cyclase

SCOPe Domain Sequences for d5d15b1:

Sequence, based on SEQRES records: (download)

>d5d15b1 d.58.29.0 (B:106-271) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgddlfgrnvamaarvaaqa
aggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavlas

Sequence, based on observed residues (ATOM records): (download)

>d5d15b1 d.58.29.0 (B:106-271) automated matches {Mycobacterium avium [TaxId: 1391991]}
rvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmvafar
peqavrcgielqralrrnaneirvrigihmgrsvrrgddlfgrnvamaarvaaqaaggei
lvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavlas

SCOPe Domain Coordinates for d5d15b1:

Click to download the PDB-style file with coordinates for d5d15b1.
(The format of our PDB-style files is described here.)

Timeline for d5d15b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d15b2