Lineage for d5elza1 (5elz A:2-267)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2123116Family c.55.1.14: Fumble-like [159623] (4 protein domains)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2123159Protein automated matches [259360] (1 species)
    not a true protein
  7. 2123160Species Staphylococcus aureus [TaxId:196620] [259361] (4 PDB entries)
  8. 2277685Domain d5elza1: 5elz A:2-267 [320986]
    Other proteins in same PDB: d5elza2
    automated match to d4nb4a_
    complexed with 3v9, adp, mg, unx

Details for d5elza1

PDB Entry: 5elz (more details), 1.8 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with a pantothenate analog
PDB Compounds: (A:) Type II pantothenate kinase

SCOPe Domain Sequences for d5elza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elza1 c.55.1.14 (A:2-267) automated matches {Staphylococcus aureus [TaxId: 196620]}
kvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaeni
nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg
gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlh
hldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedyt
vlrgckpyyvengafsgaigalylek

SCOPe Domain Coordinates for d5elza1:

Click to download the PDB-style file with coordinates for d5elza1.
(The format of our PDB-style files is described here.)

Timeline for d5elza1:

  • d5elza1 appears in periodic updates to SCOPe 2.06 starting on 2016-08-11

View in 3D
Domains from same chain:
(mouse over for more information)
d5elza2